PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_7292g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family CO-like
Protein Properties Length: 335aa    MW: 36262.9 Da    PI: 6.9307
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_7292g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.2e-072667439
      zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                  + C+ +    ++l+C+ ++ +lC  C ++ H g       H++
  MA_7292g0010 26 KPCNVCRIASASLYCRADSAYLCSGCDVKVH-GanklasrHER 67
                  68******99*********************.54677777775 PP

2zf-B_box26.61.2e-0868113342
      zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                    + C+ +e+ ++   C+ +   lC +C   +H+       H++vp+
  MA_7292g0010  68 VWLCEVCEQAPAAVTCKADAASLCVSCDADIHSAnplarrHDRVPI 113
                   689*****************************66899999*99997 PP

3CCT70.54.3e-24271314144
           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                   Rea++lRYkeKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k+ 
  MA_7292g0010 271 REARVLRYKEKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRV 314
                   9****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.1E-102370IPR000315B-box-type zinc finger
PfamPF006438.3E-62667IPR000315B-box-type zinc finger
CDDcd000211.87E-62770No hitNo description
PROSITE profilePS501199.9112870IPR000315B-box-type zinc finger
PROSITE profilePS5011910.65166113IPR000315B-box-type zinc finger
PfamPF006431.3E-668113IPR000315B-box-type zinc finger
CDDcd000211.08E-869113No hitNo description
SMARTSM003361.7E-971113IPR000315B-box-type zinc finger
PfamPF062034.3E-18271313IPR010402CCT domain
PROSITE profilePS5101716.638271313IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVKEEDCKVP KEAGIVKEFQ AWTMPKPCNV CRIASASLYC RADSAYLCSG CDVKVHGANK  60
LASRHERVWL CEVCEQAPAA VTCKADAASL CVSCDADIHS ANPLARRHDR VPIAASWLLP  120
NPKSSAEGAK NCDDGGSCFG VDAGPPVNKA AGGYFSVVDL FPDVDPYLDL DYASPLEATG  180
GTDSVVPVQS NVSSQDGAVS TPSDCFDTEK VTYSYTTTTS LSHSVSSSSL DVGVVPDATL  240
SDMSRPLNRG VFELANPGVM NVGIQYVQLD REARVLRYKE KRKNRKFEKT IRYASRKAYA  300
ETRPRIKGRF AKRVDADVAQ MYTSAELSYG LVPSF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0852780.0EF085278.1 Picea sitchensis clone WS0272_G08 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006845571.11e-100PREDICTED: zinc finger protein CONSTANS-LIKE 4
TrEMBLD5JCV20.0D5JCV2_PICLI; Putative constans-like protein (Fragment)
STRINGPP1S371_27V6.14e-98(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.13e-75CONSTANS-like 4